
LL-37 5mg
Research-grade LL-37. ≥98% purity, HPLC & MS verified. Lyophilized powder in sealed glass vial.
This product is being restocked
We're working with our supplier to restock this item. Sign up below to be the first to know, or save it to your wishlist.
Important Notice
This product is intended for laboratory and research use only. Not for human or veterinary use. By purchasing, you confirm this product will be used exclusively for in-vitro research purposes.
≥98% verified by independent HPLC analysis
Certificate of Analysis included with every order
24h dispatch, free EU shipping over €150
Independent lab verification for every batch
About LL-37 5mg
What Is LL-37?
LL-37 is a human cathelicidin antimicrobial peptide — the only cathelicidin found in the human body. It is a 37-amino acid peptide that plays a critical role in innate immunity, acting as the body's first-line defense against pathogens. Beyond its antimicrobial properties, LL-37 has been shown to modulate immune responses, promote wound healing, and influence inflammatory pathways.
Why Researchers Choose LL-37
- Broad-spectrum antimicrobial — Active against bacteria, fungi, and enveloped viruses in vitro
- Endogenous peptide — Naturally produced by human immune cells (neutrophils, macrophages, epithelial cells)
- Dual function — Both direct antimicrobial activity and immunomodulatory signaling
- Biofilm disruption — Research shows ability to disrupt established bacterial biofilms
Key Research Areas
- Innate immunity and host defense mechanisms
- Antimicrobial peptide resistance studies
- Wound healing and tissue regeneration
- Biofilm disruption and chronic infection models
- Inflammatory regulation (both pro- and anti-inflammatory)
Specifications
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | 4,493.33 Da |
| Purity | ≥98% (HPLC verified) |
| Form | Lyophilized powder |
Storage
-20°C long-term. Reconstituted: 2-8°C, use within 2 weeks.
For research purposes only. Not for human consumption.
Specification Summary
Customer Reviews
Berlin, DE
Great experience from start to finish. Ordered on Monday, had it by Thursday. Will definitely reorder.
Vienna, AT
Excellent product quality. Exactly what I was looking for and the price-to-quality ratio is unbeatable in Europe.
Zürich, CH
Second order and just as impressed. Product quality is excellent and the price is really fair for EU shipping.
Researchers Also Studied
SAME FIELDVIP
Research-grade VIP. ≥98% purity, HPLC & MS verified. Lyophilized powder in sealed glass vial.
SAME FIELDThymosin Alpha-1
Research-grade Thymosin Alpha-1. ≥98% purity, HPLC & MS verified. Lyophilized powder in sealed glass vial.
10mgSAME FIELDThymalin 10mg
Research-grade Thymalin. ≥98% purity, HPLC & MS verified. Lyophilized powder in sealed glass vial.
RESEARCHERS ALSO STUDIEDRetatrutide Research Starter Kit
Complete retatrutide research kit: 10mg vial + BAC water + syringes. Save 17% vs buying separately. For research purposes only.
Frequently Bought Together
You save €10.20 with this bundle

